Everything below concerns acetate salt. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-09-16. Numbers and descriptions here follow the published literature rather than marketing material.
Identity and purity are checked with standard peptide techniques. Reversed-phase high-performance liquid chromatography separates the main peak from closely related impurities and yields a percentage purity. Mass spectrometry confirms that the measured mass matches the theoretical value. Amino acid analysis offers an independent check on overall composition. These analytical methods characterize the material itself and reveal nothing about how it behaves in a living system.
In its common research form the peptide is supplied as a lyophilized powder. It dissolves readily in water and in typical aqueous buffers, which simplifies preparation of working solutions. Laboratories usually prepare small aliquots instead of one large volume. The dry material appears as a white to off-white solid with no distinctive odor. Bulk quantities are typically shipped in sealed vials.
Lyophilized material is generally kept cold, commonly at minus twenty degrees Celsius, and shielded from moisture and light. Solutions are less stable than the dry powder, so repeated freeze-thaw cycles are avoided by splitting the material into single-use portions. Published stability data for this particular peptide are limited, which means suggested hold times should be read as provisional. Long-term refrigeration of reconstituted solutions is not well supported by available evidence.
Identity and purity are established using reversed-phase high-performance liquid chromatography, which separates the peptide from related impurities and yields a percentage purity. Mass spectrometry, typically with electrospray ionization, confirms the molecular mass against the expected value. Amino acid analysis or peptide mapping provides additional sequence confirmation. These methods are complementary, since chromatography measures how much material is present while mass spectrometry verifies what that material is. A certificate of analysis normally reports both.
Analytical results depend on the column, gradient, and detector wavelength chosen by the laboratory, so purity values from different sources are not always directly comparable. Water content, counterion form, and residual trifluoroacetate affect both mass and purity calculations. Microbiological and endotoxin testing are separate from chemical purity and are not covered by a standard chromatographic run. Buyers evaluating a material typically request the full method description rather than a single purity figure.
Lyophilized peptide powder is generally stored at minus twenty degrees Celsius or lower and kept away from light and moisture. Under these conditions degradation is slow, and sealed vials remain stable for extended periods. Once dissolved, the material is less stable, particularly in aqueous buffers near neutral pH, where hydrolysis and oxidation proceed faster. Solutions are usually kept cold and used within days to weeks. Repeated freeze-thaw cycles are avoided because they encourage aggregation.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white lyophilized powder | Visual inspection of dry material |
| Solubility | Soluble in water | Polar aqueous solvent class |
| Typical storage | Minus 20 degrees Celsius, desiccated, dark | Applies to the lyophilized form |
| Purity assessment | Reversed-phase HPLC | Ultraviolet detection, area percent |
| Identity confirmation | Mass spectrometry | Measured mass compared with theoretical value |
Evidence in humans is limited. Small clinical studies have examined the peptide in contexts such as ulcerative colitis and wound healing, but participant numbers are small and independent replication is scarce. It is not approved as a medicine by major regulatory agencies and is distributed mainly as a research material or compounded preparation. Long-term human safety data are not established, and questions about absorption through non-injected routes remain open rather than resolved. Claims about its effects are best read against these gaps.
BPC-157 is a synthetic peptide of fifteen amino acids, written in single-letter code as GEPPPGKPADDAGLV. The sequence corresponds to a partial fragment of a protein isolated from human gastric juice, described in early reports as body protection compound. The number 157 refers to a fragment designation in that work rather than to molecular mass. Initial descriptions appeared in the early 1990s, when the fragment was reported to protect gastrointestinal tissue in animal models. Commercial material is produced by solid-phase peptide synthesis rather than extracted from biological sources.
Proposed mechanisms include interaction with the nitric oxide system, modulation of growth factor signaling, and effects on blood vessel formation. None of these has been established as the primary mode of action, and some proposed pathways rest on indirect measurements. Whether the reported effects depend on a specific receptor has not been determined. Stability in gastric acid, unusual for a peptide of this size, is also reported in animal work, but the reason for it is not firmly established.
Published studies on BPC-157 are dominated by animal models. Commonly used endpoints include healing of surgically induced lesions in the stomach, tendon-to-bone attachment after transection, and recovery from experimentally induced vascular or intestinal damage. Many of these reports come from a small number of research groups, and the peptide is often described as acting across a wide range of tissue types. That breadth is itself a point of discussion, since one molecule influencing many unrelated systems is unusual.
Physical descriptions in supplier documents and papers usually list the compound as a white to off-white powder. It dissolves readily in water and in common aqueous buffers, and solutions are often prepared fresh before an experiment. Molecular mass near 1419 daltons helps verify identity during mass spectrometry. The powder is somewhat hygroscopic, so moisture exposure can alter the measured mass of a sample. Purity is typically reported as a percentage from chromatographic analysis.
BPC-157 is a synthetic fifteen-amino-acid peptide whose sequence is GEPPPGKPADDAGLV. Its name derives from the phrase body protection compound, a term applied to a protein fraction originally detected in human gastric juice. The short peptide is not that full protein; it corresponds to a stable fragment of the larger molecule. Researchers frequently describe it as a pentadecapeptide because it contains exactly fifteen residues. Its neutral molecular mass is approximately 1419 daltons.
The sequence places several glycine and proline residues near the middle, which may influence how the chain folds in solution. The peptide is linear rather than cyclic, and it carries no disulfide bridges. Commercial material is commonly supplied as the acetate salt, although the free base and other counterion forms also appear. Because the term BPC-157 refers to a specific sequence, samples with slight sequence variants are chemically different substances. Published work generally treats the fifteen-residue sequence as the defining structure.
Quality assessment rests on two separate questions: whether the chain is the intended one, and how much of the sample is that chain. Reverse-phase high-performance liquid chromatography with ultraviolet detection is the standard purity measurement, while mass spectrometry confirms identity through the observed molecular mass. Amino acid analysis and sequence verification provide further checks. A reported purity percentage describes the proportion of the sample represented by the main peak, not the amount of peptide by mass, since counter-ions and water make up part of any lyophilized lot.
In its usual supplied form, the peptide is a white to off-white lyophilized powder that dissolves readily in water and in aqueous buffers. Powder keeps far longer than solution, so material is normally shipped and stored dry, then dissolved only when needed. Once in solution, the chain is subject to hydrolysis and the liquid supports microbial growth, and practical guidance generally treats the dissolved form as short-lived. Containers should stay sealed and desiccated, because the powder takes up moisture from air.
Long-term storage of the dry powder is typically described at minus twenty degrees Celsius or colder, while shorter holding periods may use ordinary refrigeration. Repeated warming and cooling cycles are discouraged because they stress the material and can promote aggregation or loss. Light exposure and residual moisture are both treated as avoidable sources of degradation, and working aliquots are often prepared to limit how many times a container is opened. Sealed vials with a desiccant are the usual container.
Biopharmaceuticals may be produced from microbial cells (e.g., recombinant E. coli or yeast cultures), mammalian cell lines (see Cell culture) and plant cell cultures (see Plant tissue culture) and moss plants in bioreactors of various configurations, including photo-bioreactors. Important issues of concern are cost of production (low-volume, high-purity products are desirable) and microbial contamination (by bacteria, viruses, mycoplasma). Alternative platforms of production which are being tested include whole plants (plant-made pharmaceuticals).
== External links == Table of Nuclides. DOE Fundamentals Handbook: Nuclear Physics and Reactor Theory Vol. 1 (Archived 2017-07-31 at the Wayback Machine), Vol. 2 (Archived 2016-12-20 at the Wayback Machine). Radionuclide Basics: Uranium—US EPA NLM Hazardous Substances Databank – Uranium, Radioactive "The Miracle of U-235", Popular Mechanics, January 1941—one of the earliest articles on U-235 for the general public
==== Electrolyte recycling ==== Electrolyte recycling consists of two phases. The collection phase extracts the electrolyte from the spent Li-ion battery. This can be achieved through mechanical processes, distillation, freezing, solvent extraction, and supercritical fluid extraction. Due to the volatility, flammability, and sensitivity of the electrolyte, the collection process poses a greater difficulty than the collection process for other components of a Li-ion battery. The next phase consists of separation/electrolyte regeneration. Separation consists of isolating the individual components of the electrolyte. This approach is often used for the direct recovery of the Li salts from the organic solvents. In contrast, regeneration of the electrolyte aims to preserve the electrolyte composition by removing impurities which can be achieved through filtration methods. The recycling of the electrolytes, which consists 10–15 wt.% of the Li-ion battery, provides both economic and environmental benefits. These benefits include the recovery of the valuable Li-based salts and the prevention of hazardous compounds, such as volatile organic compounds (VOCs) and carcinogens, being released into the environment. Compared to electrode recycling, less focus is placed on recycling the electrolyte of Li-ion batteries due to lower economic benefits and greater process challenges.
The manner in which the company licenses its franchisees varies depending on the region, with some regional franchises, known as master franchises, responsible for selling franchise sub-licenses on the company's behalf. Burger King's relationship with its franchises has not always been harmonious. Occasional spats between the two have caused numerous issues; in several instances, the relations between the company and its licensees have degenerated into precedent-setting court cases. Burger King's Australian franchise Hungry Jack's is the only franchise to operate under a different name due to a trademark dispute with a similarly named restaurant in Adelaide, South Australia, and a series of legal cases between the two.
Sources: en.wikipedia.org
The multiplex or Fellgett's advantage (named after Peter Fellgett). This arises from the fact that information from all wavelengths is collected simultaneously. It results in a higher signal-to-noise ratio for a given scan-time for observations limited by a fixed detector noise contribution (typically in the thermal infrared spectral region where a photodetector is limited by generation-recombination noise). For a spectrum with m resolution elements, this increase is equal to the square root of m. Alternatively, it allows a shorter scan-time for a given resolution. In practice multiple scans are often averaged, increasing the signal-to-noise ratio by the square root of the number of scans. The throughput or Jacquinot's advantage (named after Pierre Jacquinot). This results from the fact that in a dispersive instrument, the monochromator has entrance and exit slits which restrict the amount of light that passes through it. The interferometer throughput is determined only by the diameter of the collimated beam coming from the source. Although no slits are needed, FTIR spectrometers do require an aperture to restrict the convergence of the collimated beam in the interferometer. This is because convergent rays are modulated at different frequencies as the path difference is varied. Such an aperture is called a Jacquinot stop. For a given resolution and wavelength this circular aperture allows more light through than a slit, resulting in a higher signal-to-noise ratio. The wavelength accuracy or Connes's advantage (named after Janine Connes).
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== Fission-produced isotopes of caesium == The heavier isotopes have half-lives of seconds or minutes. Almost all caesium produced from nuclear fission comes from beta decay of originally more neutron-rich fission products, passing through isotopes of iodine then isotopes of xenon. Because these elements are volatile and can diffuse through nuclear fuel or air, caesium (thus its higher-Z decay products) is often created far from the original site of fission.
=== Biosimilars === Abasaglar was authorized for medical use in the European Union in September 2014. Lusduna was authorized for medical use in the European Union in January 2017. Semglee was authorized for medical use in the European Union in March 2018. Semglee (glargine-yfgn) was approved for medical use in the United States in July 2021. Rezvoglar (glargine-aglr) was approved for medical use in the United States in December 2021. In November 2025, the Committee for Medicinal Products for Human Use of the European Medicines Agency adopted a positive opinion, recommending the granting of a marketing authorization for the medicinal product Ondibta, intended for the treatment of diabetes. The applicant for this medicinal product is Gan & Lee Pharmaceuticals Europe GmbH. Ondibta is a biosimilar medicinal product that is highly similar to the reference product Lantus, which was authorized in the EU in June 2000. Ondibta was authorized for medical use in the European Union in January 2026.
=== C-terminal retention signals === While the N-terminus of a protein often contains targeting signals, the C-terminus can contain retention signals for protein sorting. The most common ER retention signal is the amino acid sequence -KDEL (Lys-Asp-Glu-Leu) or -HDEL (His-Asp-Glu-Leu) at the C-terminus. This keeps the protein in the endoplasmic reticulum and prevents it from entering the secretory pathway.
Sources: en.wikipedia.org
Analyzing proteins proves to be more difficult than analyzing nucleic acid sequences. While there are only 4 nucleotides that make up DNA, there are at least 20 different amino acids that can make up a protein. Additionally, there is currently no known high throughput technology to make copies of a single protein. Numerous methods are available to study proteins, sets of proteins, or the whole proteome. In fact, proteins are often studied indirectly, e.g. using computational methods and analyses of genomes. Only a few examples are given below.
Genes regulated by the vitamin D receptor influence a wide range of physiological processes beyond calcium homeostasis and bone metabolism. They contribute to immune function, cellular signaling, and even blood coagulation, demonstrating the broad impact of vitamin D-regulated genes on human physiology. Examples of these genes are outlined below. Vitamin D receptor-regulated genes involved in vitamin D metabolism are CYP27B1, which encodes the enzyme that produces active vitamin D. and CYP24A1, which encodes the enzyme responsible for degrading active vitamin D, In the area of calcium homeostasis and bone metabolism, several genes are regulated by vitamin D. These include TNFSF11 (RANKL), essential for bone metabolism; SPP1 (Osteopontin), which is important for bone metabolism; and BGLAP (Osteocalcin), which is involved in bone mineralization. Additional genes include TRPV6, a calcium channel critical for intestinal calcium absorption; S100G (Calbindin-D9k), a calcium-binding protein that enables calcium translocation in enterocytes; ATP2B1 (PMCA1b), a plasma membrane calcium ATPase involved in calcium extrusion from the cell; and the S100A family of genes, which encode calcium-binding proteins involved in various cellular processes. Vitamin D also plays a role in immune function, influencing genes such as CAMP (Cathelicidin Antimicrobial Peptide), which is involved in innate immune responses; CD14, which participates in innate immune responses; and HLA class II genes, which are important for adaptive immune function.
Australian Rules footballer Daniel Chick elected to have his left ring finger amputated as chronic pain and injury was limiting his performance. Rugby union player Jone Tawake also had a finger removed. National Football League safety Ronnie Lott had the tip of his little finger removed after it was damaged in the 1985 NFL season.
=== Chloroplast inheritance === Like mitochondria, chloroplasts are usually inherited from a single parent. Biparental chloroplast inheritance—where plastid genes are inherited from both parent plants—occurs in very low levels in some flowering plants. Many mechanisms prevent biparental chloroplast DNA inheritance, including selective destruction of chloroplasts or their genes within the gamete or zygote, and chloroplasts from one parent being excluded from the embryo. Parental chloroplasts can be sorted so that only one type is present in each offspring. Gymnosperms, such as pine trees, mostly pass on chloroplasts paternally, while flowering plants often inherit chloroplasts maternally. Flowering plants were once thought to only inherit chloroplasts maternally. However, there are now many documented cases of angiosperms inheriting chloroplasts paternally. Angiosperms, which pass on chloroplasts maternally, have many ways to prevent paternal inheritance. Most of them produce sperm cells that do not contain any plastids. There are many other documented mechanisms that prevent paternal inheritance in these flowering plants, such as different rates of chloroplast replication within the embryo. Among angiosperms, paternal chloroplast inheritance is observed more often in hybrids than in offspring from parents of the same species. This suggests that incompatible hybrid genes might interfere with the mechanisms that prevent paternal inheritance.
The escalating deadlock sparked international anxiety over a potential collapse of the 2022 peace framework. On April 30, 2026, the European Union issued a formal warning expressing "great concern" over the unilateral developments. The EU spokesperson demanded an "immediate de-escalation" of political tensions, warning that a return to armed conflict would have catastrophic humanitarian consequences for a population already suffering from widespread food insecurity and institutional collapse.
Sources: en.wikipedia.org
Dry powder is commonly held at minus twenty degrees Celsius, desiccated and away from light. Cold storage slows degradation of the lyophilized material.
Mass spectrometry establishes the molecular mass, and reversed-phase chromatography reports purity. A certificate of analysis typically combines both results.
Solutions degrade faster than the dry powder, particularly at room temperature. Portioning into single-use aliquots and freezing reduces losses from repeated thawing.
Bacteriostatic water or sterile saline is commonly used to dissolve the powder. The choice of solvent affects stability and preservation. Aqueous solutions are kept refrigerated and are not intended for long-term storage.